Senolytic
FOXO4-DRI
FOXO4-DRI is a D-retro-inverso peptide designed to disrupt the interaction between FOXO4 and p53 in senescent cells. By blocking this protein-protein interaction, it forces nuclear exclusion of p53, triggering intrinsic apoptosis specifically in senescent cells while sparing healthy cells. This senolytic mechanism has shown promise in preclinical models of aging, restoring fitness, fur density, and renal function in aged mice.
Quick Facts
Also known asFOXO4-D-Retro-Inverso
CategorySenolytic
Half-life~2 days
Routessubcutaneous, intravenous
Common vial sizes10mg
Molecular weight5358.2 Da
Chain length46 amino acids
Sequenceltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all D-amino acids)
FDA statusNot approved
Storage-20°C (frozen). Reconstituted: 7 days.
Dosing Protocols
| Goal | Dose | Frequency | Route | Cycle | Notes |
|---|---|---|---|---|---|
| Anecdotal Human Senolytic Protocol | 25 mg | every other day x3 doses | subcutaneous | 1 weeks on / 4 weeks off | ~25mg per injection, 3 injections on days 1, 3, 5 (75-100mg total per cycle). Monthly cycles. No human clinical trials exist. All data from mouse studies. |
| Mouse Research Protocol (IV) | every other day x3 doses | intravenous | 1 weeks | 5mg/kg every other day x3 doses. Weight-based dosing. Mouse research only. |
Protocols shown are for informational purposes only. Consult a healthcare provider before starting any peptide protocol.
Track Your FOXO4-DRI Protocol
Log doses, manage vial inventory, set injection reminders, and visualize blood concentration levels.
Start Tracking — FreeCommon Questions
How do I reconstitute FOXO4-DRI?
Add bacteriostatic water to your FOXO4-DRI vial (common sizes: 10mg). The amount of BAC water depends on your desired concentration. Use our reconstitution calculator for exact measurements.
What is the typical dose of FOXO4-DRI?
A common dose for FOXO4-DRI is 25 mg every other day x3 doses via subcutaneous. ~25mg per injection, 3 injections on days 1, 3, 5 (75-100mg total per cycle). Monthly cycles. No human clinical trials exist. All data from mouse studies.
What is the half-life of FOXO4-DRI?
The half-life of FOXO4-DRI is approximately ~2 days. This determines how long the peptide remains active in your body and influences dosing frequency.
How should I store FOXO4-DRI?
Store FOXO4-DRI at -20°C (frozen). D-retro-inverso peptides are protease-resistant but require careful storage. Store lyophilized at -20°C. Reconstitute in small aliquots to avoid repeated freeze-thaw. Once reconstituted, use within 7 days.
Is FOXO4-DRI FDA approved?
FOXO4-DRI is not FDA approved and is available for research purposes only. It has not been evaluated by the FDA for safety or efficacy in humans.
References
- Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis - Baar et al. (2017) (pubmed)
- FOXO4-DRI Alleviates Age-Related Testosterone Secretion Insufficiency - Zhang et al. (2020) (pubmed)
- Senolytic FOXO4-DRI Removes Senescent Human Chondrocytes - Stegen et al. (2021) (pubmed)
- FOXO4 peptide targets myofibroblast ameliorates bleomycin-induced pulmonary fibrosis - Han et al. (2022) (pubmed)
- FOXO4-D-Retro-Inverso targets extracellular matrix production in fibroblasts - Liu et al. (2023) (pubmed)
- Development of a novel senolytic by precise disruption of FOXO4-p53 complex - Le et al. (2021) (pubmed)