Quick Facts

Also known asFOXO4-D-Retro-Inverso
CategorySenolytic
Half-life~2 days
Routessubcutaneous, intravenous
Common vial sizes10mg
Molecular weight5358.2 Da
Chain length46 amino acids
Sequenceltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all D-amino acids)
FDA statusNot approved
Storage-20°C (frozen). Reconstituted: 7 days.

Dosing Protocols

Goal Dose Frequency Route Cycle Notes
Anecdotal Human Senolytic Protocol 25 mg every other day x3 doses subcutaneous 1 weeks on / 4 weeks off ~25mg per injection, 3 injections on days 1, 3, 5 (75-100mg total per cycle). Monthly cycles. No human clinical trials exist. All data from mouse studies.
Mouse Research Protocol (IV) every other day x3 doses intravenous 1 weeks 5mg/kg every other day x3 doses. Weight-based dosing. Mouse research only.

Protocols shown are for informational purposes only. Consult a healthcare provider before starting any peptide protocol.

Reconstitution Calculator for FOXO4-DRI

Pre-filled for FOXO4-DRI 10mg vial. Adjust values as needed.

Open Full Calculator

Track Your FOXO4-DRI Protocol

Log doses, manage vial inventory, set injection reminders, and visualize blood concentration levels.

Start Tracking — Free

Common Questions

How do I reconstitute FOXO4-DRI?
Add bacteriostatic water to your FOXO4-DRI vial (common sizes: 10mg). The amount of BAC water depends on your desired concentration. Use our reconstitution calculator for exact measurements.
What is the typical dose of FOXO4-DRI?
A common dose for FOXO4-DRI is 25 mg every other day x3 doses via subcutaneous. ~25mg per injection, 3 injections on days 1, 3, 5 (75-100mg total per cycle). Monthly cycles. No human clinical trials exist. All data from mouse studies.
What is the half-life of FOXO4-DRI?
The half-life of FOXO4-DRI is approximately ~2 days. This determines how long the peptide remains active in your body and influences dosing frequency.
How should I store FOXO4-DRI?
Store FOXO4-DRI at -20°C (frozen). D-retro-inverso peptides are protease-resistant but require careful storage. Store lyophilized at -20°C. Reconstitute in small aliquots to avoid repeated freeze-thaw. Once reconstituted, use within 7 days.
Is FOXO4-DRI FDA approved?
FOXO4-DRI is not FDA approved and is available for research purposes only. It has not been evaluated by the FDA for safety or efficacy in humans.

References